You Searched For: Ties

Electrode filling solutions used with pH electrodes and reference electrodes maintains proper functioning. These filling solutions are designed to enhance the performance and extend the life of electrodes, with certain filling solutions specifically engineered to be used with ion-selective electrodes and other specialized instruments. The electrode filling solutions are made from the highest quality reagents to provide optimum performance and come in a range of volumes.

Electrode filling solutions used with pH electrodes and reference electrodes maintains proper functioning. These filling solutions are designed to enhance the performance and extend the life of electrodes, with certain filling solutions specifically engineered to be used with ion-selective electrodes and other specialized instruments. The electrode filling solutions are made from the highest quality reagents to provide optimum performance and come in a range of volumes.


112  results were found

Sort Results

List View Easy View
SearchResultCount:"112"
Description: Anti-EP4 receptor C-terminal amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI) Rabbit Polyclonal Antibody (APC (Allophycocyanin))
Catalog Number: COBSD3-1866-50
UOM: 1 * 50 µG
Supplier: Columbia Biosciences


Description: Anti-IgG Goat Polyclonal Antibody (RPE (R-Phycoerythrin))
Catalog Number: COBSD5-110-1MG
UOM: 1 * 100 µG
Supplier: Columbia Biosciences


Description: Anti-T7 Tag Rabbit Polyclonal Antibody (DyLight® 488)
Catalog Number: COBSD8-1832
UOM: 1 * 100 µG
Supplier: Columbia Biosciences


Description: Anti-IgM Goat Polyclonal Antibody (RPE (R-Phycoerythrin))
Catalog Number: COBSD5-112-M
UOM: 1 * 100 µG
Supplier: Columbia Biosciences


Description: Anti-DYKDDDDK Tag Mouse Monoclonal Antibody (APC (Allophycocyanin)) [clone: M2]
Catalog Number: COBSD3-1718-100
UOM: 1 * 100 µG
Supplier: Columbia Biosciences


Description: Anti-IgG Goat Polyclonal Antibody (RPE (R-Phycoerythrin))
Catalog Number: COBSD5-114-100
UOM: 1 * 100 µG
Supplier: Columbia Biosciences


Description: Anti-IgG Goat Polyclonal Antibody (RPE (R-Phycoerythrin))
Catalog Number: COBSD5-112-FAB
UOM: 1 * 100 µG
Supplier: Columbia Biosciences


Description: Anti-HA tag Rabbit Polyclonal Antibody (RPE (R-Phycoerythrin))
Catalog Number: COBSD5-1830
UOM: 1 * 100 µG
Supplier: Columbia Biosciences


Description: Anti-S Tag Rabbit Polyclonal Antibody (RPE (R-Phycoerythrin))
Catalog Number: COBSD5-1831
UOM: 1 * 100 µG
Supplier: Columbia Biosciences


Description: Anti-V5 Tag Rabbit Polyclonal Antibody (RPE (R-Phycoerythrin))
Catalog Number: COBSD5-1834
UOM: 1 * 100 µG
Supplier: Columbia Biosciences


Description: Anti-T7 Tag Rabbit Polyclonal Antibody (DyLight® 650)
Catalog Number: COBSD10-1832
UOM: 1 * 100 µG
Supplier: Columbia Biosciences


Description: Anti-V5 Tag Rabbit Polyclonal Antibody (DyLight® 650)
Catalog Number: COBSD10-1834
UOM: 1 * 100 µG
Supplier: Columbia Biosciences


Description: Anti-HA tag Mouse Monoclonal Antibody (Biotin) [clone: 16B12]
Catalog Number: COBSB1-1722
UOM: 1 * 100 µG
Supplier: Columbia Biosciences


Description: Anti-IgG2a Goat Polyclonal Antibody (APC (Allophycocyanin))
Catalog Number: COBSD3-112-2A
UOM: 1 * 100 µG
Supplier: Columbia Biosciences


Description: Mouse IgG2b Isotype Control (APC (Allophycocyanin))
Catalog Number: COBSD3-1602B
UOM: 1 * 100 µG
Supplier: Columbia Biosciences


Description: Anti-IgM Goat Polyclonal Antibody (APC (Allophycocyanin))
Catalog Number: COBSD3-110-M
UOM: 1 * 100 µG
Supplier: Columbia Biosciences


65 - 80 of 112